
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LILRB5 Antibody
상품 한눈에 보기
인간 LILRB5 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 적합하며, CD85c/LIR8로도 알려진 표적 단백질 검출에 사용 가능. PBS-글리세롤 버퍼에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA012069-100 Anti-LILRB5 Antibody, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012069-25 Anti-LILRB5 Antibody, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LILRB5 Antibody
Anti-LILRB5 Antibody
제품 설명
Polyclonal Antibody against Human LILRB5
(leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5)
권장 응용
- Immunohistochemistry (IHC)
대체 유전자명
CD85c, LIR-8, LIR8
표적 단백질 정보
| 항목 | 내용 |
|---|---|
| Target Protein | leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5 |
| Target Gene | LILRB5 |
| Alternative Gene Names | CD85c, LIR-8, LIR8 |
항원 서열
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG종 특이성 검증
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000046683 (56%), Mouse ENSMUSG00000062593 (55%) |
항체 특성
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
완충액 구성
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
주의사항
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 최적화된 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



