CacheBy
Atlas Antibodies Anti-LILRA4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LILRA4 Antibody

상품 한눈에 보기

인간 LILRA4 단백질을 표적으로 하는 폴리클로날 토끼 항체. 면역조직화학(IHC) 등 다양한 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 안정적 PBS/glycerol 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049418-100 Anti-LILRA4 Antibody, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049418-25 Anti-LILRA4 Antibody, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LILRA4 Antibody

Anti-LILRA4 Antibody

Target: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human LILRA4.

Alternative Gene Names

  • CD85g
  • ILT7

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
Target Gene LILRA4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000058538 (52%), Mouse ENSMUSG00000062593 (52%)

Antigen Sequence:
DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.