CacheBy
Atlas Antibodies Anti-LDLRAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LDLRAP1 Antibody

상품 한눈에 보기

Human LDLRAP1 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit 유래 IgG로 제작되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합. Affinity purification을 통해 높은 순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050358-100 Anti-LDLRAP1 Antibody, low density lipoprotein receptor adaptor protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050358-25 Anti-LDLRAP1 Antibody, low density lipoprotein receptor adaptor protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LDLRAP1 Antibody

Anti-LDLRAP1 Antibody

Target: Low density lipoprotein receptor adaptor protein 1 (LDLRAP1)

면역조직화학 (IHC)

Product Description

Polyclonal antibody against Human LDLRAP1.

Alternative Gene Names

ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705

Open Datasheet

Target Information

항목 내용
Target Protein Low density lipoprotein receptor adaptor protein 1
Target Gene LDLRAP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000037295 (87%), Rat ENSRNOG00000000151 (86%)

Antigen Sequence

MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.