CacheBy
Atlas Antibodies Anti-LDOC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LDOC1 Antibody

상품 한눈에 보기

Human LDOC1 단백질을 인식하는 Rabbit Polyclonal Antibody로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반 PBS buffer에 보존. LDOC1 관련 암 연구 및 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061842-100 Anti-LDOC1 Antibody, leucine zipper, down-regulated in cancer 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061842-25 Anti-LDOC1 Antibody, leucine zipper, down-regulated in cancer 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LDOC1 Antibody

Anti-LDOC1 Antibody

Target Protein: leucine zipper, down-regulated in cancer 1 (LDOC1)

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human LDOC1

Alternative Gene Names

  • BCUR1
  • Mar7
  • Mart7

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIV

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000057615 77%
Rat ENSRNOG00000003409 74%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.