
원본
Atlas Antibodies Anti-LECT2 Antibody
상품 한눈에 보기
Human LECT2 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역조직화학 등 연구용에 적합. PrEST 항원을 이용해 친화 정제됨. 사람에 대해 검증되었으며, Rat 및 Mouse와 높은 서열 유사성 보유. 안정적 PBS/glycerol buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043883-100 Anti-LECT2 Antibody, leukocyte cell-derived chemotaxin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043883-25 Anti-LECT2 Antibody, leukocyte cell-derived chemotaxin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LECT2 Antibody
Anti-LECT2 Antibody
Target: leukocyte cell-derived chemotaxin 2 (LECT2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human LECT2.
Alternative Gene Names
chm-II, chm2
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leukocyte cell-derived chemotaxin 2 |
| Target Gene | LECT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPT |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000012189 (92%), Mouse ENSMUSG00000021539 (91%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



