원본

Atlas Antibodies Anti-LDOC1 Antibody

상품 한눈에 보기

인간 LDOC1 단백질을 표적으로 하는 폴리클로날 항체로, 다양한 암 연구에 활용 가능. Rabbit 유래 IgG 항체이며 Affinity purification으로 정제됨. IHC 등 응용에 적합하며, 인간에서 검증된 반응성을 보임.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051768-100 Anti-LDOC1 Antibody, leucine zipper, down-regulated in cancer 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051768-25 Anti-LDOC1 Antibody, leucine zipper, down-regulated in cancer 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leucine zipper, down-regulated in cancer 1 (LDOC1)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)

Polyclonal antibody against human LDOC1.

BCUR1, Mar7, Mart7

항목	내용
Target Protein	leucine zipper, down-regulated in cancer 1
Target Gene	LDOC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000057615 (77%), Rat ENSRNOG00000003409 (74%)

Antigen Sequence:
NSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIV

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand