
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LAT Antibody
상품 한눈에 보기
인간 LAT 단백질에 대한 폴리클로날 항체로 T 세포 활성화 연구에 적합. IHC, WB, ICC 등 다양한 응용에 사용 가능. 정제된 Rabbit IgG 항체로 높은 특이성과 재현성 제공. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA011157-100 Anti-LAT Antibody, linker for activation of T cells 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011157-25 Anti-LAT Antibody, linker for activation of T cells 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LAT Antibody
Anti-LAT Antibody
Linker for activation of T cells
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human LAT.
Alternative Gene Names
- LAT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | linker for activation of T cells |
| Target Gene | LAT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000017429 (67%), Mouse ENSMUSG00000030742 (67%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.


