CacheBy
Atlas Antibodies Anti-LAT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LAT Antibody

상품 한눈에 보기

인간 LAT 단백질에 대한 폴리클로날 항체로 T 세포 활성화 연구에 적합. IHC, WB, ICC 등 다양한 응용에 사용 가능. 정제된 Rabbit IgG 항체로 높은 특이성과 재현성 제공. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011157-100 Anti-LAT Antibody, linker for activation of T cells 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011157-25 Anti-LAT Antibody, linker for activation of T cells 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LAT Antibody

Anti-LAT Antibody

Linker for activation of T cells


  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human LAT.


Alternative Gene Names

  • LAT1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein linker for activation of T cells
Target Gene LAT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000017429 (67%), Mouse ENSMUSG00000030742 (67%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.