원본

Atlas Antibodies Anti-LARS2 Antibody

상품 한눈에 보기

Human LARS2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, Human에 대한 반응성이 검증되었습니다. 안정화용 글리세롤 및 보존제가 포함되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066085-100 Anti-LARS2 Antibody, leucyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066085-25 Anti-LARS2 Antibody, leucyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leucyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Polyclonal Antibody against Human LARS2

KIAA0028, LEURS, MGC26121

Target Protein: leucyl-tRNA synthetase 2, mitochondrial
Target Gene: LARS2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)