CacheBy
Atlas Antibodies Anti-ADGRA2 Antibody
원본

Atlas Antibodies Anti-ADGRA2 Antibody

상품 한눈에 보기

인간 ADGRA2 단백질을 인식하는 토끼 폴리클로날 항체. 면역조직화학 등 다양한 연구용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며 마우스, 랫과 78% 서열 유사성 보유. 안정한 PBS 글리세롤 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012393-100 Anti-ADGRA2 Antibody, adhesion G protein-coupled receptor A2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012393-25 Anti-ADGRA2 Antibody, adhesion G protein-coupled receptor A2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRA2 Antibody

Anti-ADGRA2 Antibody

Target: adhesion G protein-coupled receptor A2 (ADGRA2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ADGRA2.


Alternative Gene Names

DKFZp434C211, DKFZp434J0911, FLJ14390, GPR124, KIAA1531, TEM5

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adhesion G protein-coupled receptor A2
Target Gene ADGRA2
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031486 (78%), Rat ENSRNOG00000012991 (78%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSAAPLSEAGRAGQRRSASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAEVASGGCMKTGLWK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.