CacheBy
Atlas Antibodies Anti-ADD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADD1 Antibody

상품 한눈에 보기

Human ADD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 사람에 대한 검증 완료, 마우스 및 랫트와 교차 반응 가능성이 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035874-100 Anti-ADD1 Antibody, adducin 1 (alpha) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035874-25 Anti-ADD1 Antibody, adducin 1 (alpha) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADD1 Antibody

Anti-ADD1 Antibody

Target Protein: adducin 1 (alpha)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Independent antibody validation: 단백질의 다른 에피토프를 인식하는 항체와 비교하여 IHC에서의 발현 검증 수행
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human ADD1 (adducin 1, alpha).

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein adducin 1 (alpha)
Target Gene ADD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRP
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029106 (72%), Rat ENSRNOG00000013039 (63%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.