Atlas Antibodies Anti-ADAMTS2 Antibody

상품 한눈에 보기

인간 ADAMTS2 단백질을 인식하는 폴리클로날 항체. 면역세포화학 등 다양한 응용에 적합. 토끼 유래 IgG 형식으로 제작되어 높은 특이성과 재현성을 제공. 친화 정제된 고순도 항체로 안정적인 PBS/glycerol 버퍼에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028363-100 Anti-ADAMTS2 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028363-25 Anti-ADAMTS2 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: ADAM metallopeptidase with thrombospondin type 1 motif 2
Supplier: Atlas Antibodies

Polyclonal antibody against human ADAMTS2.

ADAM-TS2, ADAMTS-3, hPCPNI, NPI, PCINP

Target Protein: ADAM metallopeptidase with thrombospondin type 1 motif 2
Target Gene: ADAMTS2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand