Atlas Antibodies Anti-ADAMTS2 Antibody

상품 한눈에 보기

인간 ADAMTS2 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합합니다. 친화성 정제된 고품질 Rabbit IgG 항체이며, 인간에 대한 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존제를 포함합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028444-100 Anti-ADAMTS2 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028444-25 Anti-ADAMTS2 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

ADAM metallopeptidase with thrombospondin type 1 motif 2 단백질을 인식하는 폴리클로날 항체입니다.

Polyclonal Antibody against Human ADAMTS2

ADAM-TS2, ADAMTS-3, hPCPNI, NPI, PCINP

항목	내용
Target Protein	ADAM metallopeptidase with thrombospondin type 1 motif 2
Target Gene	ADAMTS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000061484 (83%), Mouse ENSMUSG00000036545 (79%)

Antigen Sequence:

IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand