Atlas Antibodies Anti-ACY3 Antibody
상품 한눈에 보기
Human ACY3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. Recombinant PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 부분적 상동성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACY3 Antibody
Target: aspartoacylase (aminocyclase) 3
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ACY3
Alternative Gene Names
ACY-3, HCBP1, MGC9740
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aspartoacylase (aminocyclase) 3 |
| Target Gene | ACY3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000017901 (56%), Mouse ENSMUSG00000024866 (48%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.