Atlas Antibodies Anti-ACY3 Antibody

상품 한눈에 보기

Human ACY3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. Recombinant PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 부분적 상동성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039219-100 Anti-ACY3 Antibody, aspartoacylase (aminocyclase) 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039219-25 Anti-ACY3 Antibody, aspartoacylase (aminocyclase) 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: aspartoacylase (aminocyclase) 3
Supplier: Atlas Antibodies

IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human ACY3

ACY-3, HCBP1, MGC9740

항목	내용
Target Protein	aspartoacylase (aminocyclase) 3
Target Gene	ACY3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000017901 (56%), Mouse ENSMUSG00000024866 (48%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.