Atlas Antibodies Anti-ACVR1C Antibody

상품 한눈에 보기

Human ACVR1C를 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. ACVRLK7, ALK7 대체 유전자명으로도 알려져 있습니다.

카탈로그번호: HPA011933-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011933-100 Anti-ACVR1C Antibody, activin A receptor, type IC 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011933-25 Anti-ACVR1C Antibody, activin A receptor, type IC 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACVR1C Antibody

Anti-ACVR1C Antibody

Target Information

Target Protein: activin A receptor, type IC
Target Gene: ACVR1C
Alternative Gene Names: ACVRLK7, ALK7

Recommended Applications

Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human ACVR1C

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026834 (96%)
Rat ENSRNOG00000004828 (96%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand