Atlas Antibodies Anti-ACO2 Antibody

상품 한눈에 보기

인간 ACO2(aconitase 2, mitochondrial)에 특이적인 폴리클로날 항체로 IHC, WB, ICC에 적합. Rabbit 유래 IgG로 정제된 고품질 항체이며, 인간·마우스·랫트 간 높은 교차 반응성(97%)을 보임. PrEST 항원으로 친화 정제되어 신뢰성 높은 단백질 발현 분석에 적합.

카탈로그번호: HPA001097-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001097-100 Anti-ACO2 Antibody, aconitase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001097-25 Anti-ACO2 Antibody, aconitase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACO2 Antibody

Anti-ACO2 Antibody

Target: aconitase 2, mitochondrial
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human ACO2

Alternative Gene Names

ACONM

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	aconitase 2, mitochondrial
Target Gene	ACO2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000022477 (97%) / Rat ENSRNOG00000024128 (97%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG