Atlas Antibodies Anti-ACO1 Antibody

상품 한눈에 보기

Human ACO1 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 검증하였으며, 고순도 Affinity purification 방식으로 정제되었습니다.

카탈로그번호: HPA019371-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019371-100 Anti-ACO1 Antibody, aconitase 1, soluble 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019371-25 Anti-ACO1 Antibody, aconitase 1, soluble 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACO1 Antibody

Anti-ACO1 Antibody

Target Protein: aconitase 1, soluble
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ACO1

Alternative Gene Names

IREB1, IREBP, IRP1

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	aconitase 1, soluble
Target Gene	ACO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000005849 (90%), Mouse ENSMUSG00000028405 (89%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.