AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ACKR3 Antibody
상품 한눈에 보기
Human ACKR3를 인식하는 폴리클로날 항체로, WB 및 ICC에 적합. Rabbit host에서 생산되었으며, PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증된 반응성을 가지며, glycerol 및 PBS buffer로 안정화됨.
- 카탈로그번호
- HPA032003-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA032003-100 Anti-ACKR3 Antibody, atypical chemokine receptor 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032003-25 Anti-ACKR3 Antibody, atypical chemokine receptor 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ACKR3 Antibody
Anti-ACKR3 Antibody
Target Information
- Target Protein: Atypical chemokine receptor 3
- Target Gene: ACKR3
- Alternative Gene Names: CMKOR1, CXCR7, GPR159, RDC1
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ACKR3.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Species Reactivity
- Verified Reactivity: Human
- Interspecies Identity:
- Rat ENSRNOG00000019622 (84%)
- Mouse ENSMUSG00000044337 (84%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.