CacheBy
Atlas Antibodies Anti-ACKR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACKR2 Antibody

상품 한눈에 보기

Human ACKR2를 표적으로 하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation을 통해 검증됨. Recombinant PrEST 항원을 사용한 Affinity 정제. 다양한 조직에서 RNA-seq 데이터와 비교하여 단백질 발현 확인 가능. PBS/glycerol buffer에 보존된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA013819-100 Anti-ACKR2 Antibody, atypical chemokine receptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013819-25 Anti-ACKR2 Antibody, atypical chemokine receptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACKR2 Antibody

Anti-ACKR2 Antibody

Target: atypical chemokine receptor 2 (ACKR2)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human ACKR2


Alternative Gene Names

CCBP2, CCR10, CCR9, CMKBR9, D6

Open Datasheet


Specifications

항목 내용
Target Protein atypical chemokine receptor 2
Target Gene ACKR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000044534 (56%), Rat ENSRNOG00000019472 (56%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

관련 문서

Material Safety Data Sheet (MSDS)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.