CacheBy
Atlas Antibodies Anti-AARSD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AARSD1 Antibody

상품 한눈에 보기

Human AARSD1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 고순도, 높은 특이성 및 재현성을 제공. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유.

카탈로그번호
HPA022869-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022869-100 Anti-AARSD1 Antibody, alanyl-tRNA synthetase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022869-25 Anti-AARSD1 Antibody, alanyl-tRNA synthetase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AARSD1 Antibody

Anti-AARSD1 Antibody

Target: alanyl-tRNA synthetase domain containing 1 (AARSD1)
Type: Polyclonal Antibody against Human AARSD1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human AARSD1 protein.
Purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • MGC2744

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein alanyl-tRNA synthetase domain containing 1
Target Gene AARSD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Verified Species Reactivity Human
Interspecies Identity Mouse (92%), Rat (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.