
1 / 2
Atlas Antibodies Anti-AARS2 Antibody
상품 한눈에 보기
Human AARS2 단백질에 특이적인 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 제품으로 높은 특이성과 재현성을 제공. PBS와 글리세롤 기반 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AARS2 Antibody
Target: alanyl-tRNA synthetase 2, mitochondrial
Type: Polyclonal Antibody against Human AARS2
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against Human AARS2 (alanyl-tRNA synthetase 2, mitochondrial).
Alternative Gene Names
AARSL, bA444E17.1, KIAA1270
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alanyl-tRNA synthetase 2, mitochondrial |
| Target Gene | AARS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (81%), Mouse (76%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




