CacheBy
Atlas Antibodies Anti-AARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AARS2 Antibody

상품 한눈에 보기

Human AARS2 단백질에 특이적인 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 제품으로 높은 특이성과 재현성을 제공. PBS와 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035636-100 Anti-AARS2 Antibody, alanyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035636-25 Anti-AARS2 Antibody, alanyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AARS2 Antibody

Anti-AARS2 Antibody

Target: alanyl-tRNA synthetase 2, mitochondrial
Type: Polyclonal Antibody against Human AARS2


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against Human AARS2 (alanyl-tRNA synthetase 2, mitochondrial).


Alternative Gene Names

AARSL, bA444E17.1, KIAA1270

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein alanyl-tRNA synthetase 2, mitochondrial
Target Gene AARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP
Verified Species Reactivity Human
Interspecies Identity Rat (81%), Mouse (76%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.