
원본
Thermo Fisher Scientific DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)
상품 한눈에 보기
Gastrointestinal stromal tumor(GIST) 진단용 DOG-1 단클론 항체. 인간 시료에 반응하며 IHC(P), IHC(PFA)에서 사용 가능. 단백질 A/G 정제, 액상 형태, 4°C 보관. 연구용 전용 시약.
- 카탈로그번호
- 55107-MSM3-Px (2개 옵션)
- 판매단위
- pk
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 03:42
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific 55107-MSM3-P1 DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1) 100 ug pk판매 단위 pk ·
재고 확인 필요
900,300원VAT 포함 990,330원
Thermo Fisher Scientific 55107-MSM3-P0 DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1) 20 ug pk판매 단위 pk ·
재고 확인 필요
449,700원VAT 포함 494,670원
Thermo Fisher Scientific · Thermo Fisher Scientific DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Assay-dependent
Immunohistochemistry (PFA fixed) (IHC (PFA))
- 1–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | DG1/447, DOG-1.1 |
| Immunogen | Recombinant human DOG-1 protein (DG1/447) + synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 200 µg/mL |
| Purification | Protein A/G |
| Storage Buffer | PBS, pH 7.4, with 0.05% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | 4°C, do not freeze |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
DOG-1 is a novel marker expressed ubiquitously in gastrointestinal stromal tumors (GIST), regardless of KIT or PDGFRα mutation status.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
