원본
Thermo Fisher Scientific DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)
상품 한눈에 보기
Gastrointestinal stromal tumor(GIST) 특이 마커인 DOG-1/ANO1 단일클론 항체. 인간 시료에 반응하며 IHC(P) 및 IHC(PFA)에서 사용 가능. Recombinant DOG-1 단백질 및 합성 펩타이드로 면역원 제작. 단백질 A/G 정제, 액상 형태, 1 mg/mL 농도.
- 카탈로그번호
- 55107MSM3P1ABX
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 12:24
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific 55107MSM3P1ABX DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1) 100 ug pk판매 단위 pk ·
재고 확인 필요
900,300원VAT 포함 990,330원
Thermo Fisher Scientific · Thermo Fisher Scientific DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Assay-dependent
Immunohistochemistry (PFA fixed) (IHC (PFA))
- 1–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | DG1/447, DOG-1.1 |
| Immunogen | Recombinant human DOG-1 protein (DG1/447) + synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein A/G |
| Storage buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Wet ice |
Target Information
DOG-1, the novel marker, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFR alpha mutation status.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific DOG-1/TMEM16A Monoclonal Antibody (DG1, 1484)825,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)449,700원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific DOG-1/TMEM16A (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DOG-1.1)900,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific DOG-1/TMEM16A (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DOG-1.1)449,700원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.