Atlas Antibodies Anti-KPTN Antibody

상품 한눈에 보기

휴먼 KPTN 단백질을 인식하는 폴리클로날 항체로, actin 결합 단백질 연구에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. IHC 등 다양한 응용에 사용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041796-100 Anti-KPTN Antibody, kaptin (actin binding protein) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041796-25 Anti-KPTN Antibody, kaptin (actin binding protein) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: kaptin (actin binding protein)
Type: Polyclonal Antibody against Human KPTN

Polyclonal antibody targeting human KPTN (kaptin, actin binding protein).

항목	내용
Target Protein	kaptin (actin binding protein)
Target Gene	KPTN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000006021 (86%), Rat ENSRNOG00000001493 (82%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand