CacheBy
Atlas Antibodies Anti-KRAS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KRAS Antibody

상품 한눈에 보기

인간 KRAS 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인간, 생쥐, 랫드 종에서 반응성이 검증되었습니다.

카탈로그번호
HPA049830-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049830-100 Anti-KRAS Antibody, Kirsten rat sarcoma viral oncogene homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049830-25 Anti-KRAS Antibody, Kirsten rat sarcoma viral oncogene homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KRAS Antibody

Anti-KRAS Antibody

Kirsten rat sarcoma viral oncogene homolog

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human KRAS.

Alternative Gene Names

KRAS1, KRAS2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Kirsten rat sarcoma viral oncogene homolog
Target Gene KRAS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009338 (100%), Mouse ENSMUSG00000030265 (100%)

Antigen Sequence:
EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.