CacheBy
Atlas Antibodies Anti-KLHDC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KLHDC3 Antibody

상품 한눈에 보기

Human KLHDC3 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Rat, Mouse에서 반응 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030132-100 Anti-KLHDC3 Antibody, kelch domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030132-25 Anti-KLHDC3 Antibody, kelch domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KLHDC3 Antibody

Anti-KLHDC3 Antibody

Target: kelch domain containing 3 (KLHDC3)
Type: Polyclonal Antibody against Human KLHDC3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human KLHDC3 protein.


Alternative Gene Names

  • dJ20C7.3
  • hPeas
  • PEAS

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
SPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISR


Species Reactivity

  • Verified: Human
  • Orthologs:
    • Rat (ENSRNOG00000017495) — 100% identity
    • Mouse (ENSMUSG00000063576) — 98% identity

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Preservative Sodium azide (see MSDS)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.