CacheBy
Atlas Antibodies Anti-KLHDC10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KLHDC10 Antibody

상품 한눈에 보기

Human KLHDC10 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. 인간 및 설치류 시료에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020119-100 Anti-KLHDC10 Antibody, kelch domain containing 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020119-25 Anti-KLHDC10 Antibody, kelch domain containing 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KLHDC10 Antibody

Anti-KLHDC10 Antibody

Target: kelch domain containing 10 (KLHDC10)
Type: Polyclonal Antibody against Human KLHDC10


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human KLHDC10.
Alternative gene names: KIAA0265, slim

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein kelch domain containing 10
Target Gene KLHDC10
Alternative Names KIAA0265, slim
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK
Verified Species Reactivity Human, Rat
Interspecies Identity Rat ENSRNOG00000010267 (99%), Mouse ENSMUSG00000029775 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.