원본
Thermo Fisher Scientific DNAJC10 Polyclonal Antibody
상품 한눈에 보기
DNAJC10 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot, ICC/IF, ELISA에 적합합니다. 인간 및 마우스 반응성, 고순도 Affinity Chromatography 정제, 안정한 PBS/glycerol 저장 용액 형태입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 02:20
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA588377 DNAJC10 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
618,800원VAT 포함 680,680원
Thermo Fisher Scientific · Thermo Fisher Scientific DNAJC10 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunocytochemistry (ICC/IF) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 614–793 of human DNAJC10 (NP_0618541) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.68 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2804867 |
Product Specific Information
- Immunogen sequence: IDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
- Positive Samples: U-87MG, HT-29, SKOV3, Raji, SGC-7901
- Cellular Location: Endoplasmic reticulum lumen
Target Information
This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific CHD9 Polyclonal Antibody618,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TCP1 eta Polyclonal Antibody618,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SLC25A24 Polyclonal Antibody618,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SGK2 Polyclonal Antibody618,800원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.