AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-JAM3 Antibody
상품 한눈에 보기
Human JAM3 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체. Human에 대한 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050434-100 Anti-JAM3 Antibody, junctional adhesion molecule 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050434-25 Anti-JAM3 Antibody, junctional adhesion molecule 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-JAM3 Antibody
Anti-JAM3 Antibody
Target Protein: Junctional adhesion molecule 3 (JAM3)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human JAM3.
Alternative Gene Names: JAM-C, JAMC
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG
Species Reactivity
Verified Species: Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000031990) – 87%
- Rat (ENSRNOG00000009149) – 85%
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.