CacheBy
Atlas Antibodies Anti-JAM3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-JAM3 Antibody

상품 한눈에 보기

Human JAM3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 40% glycerol 기반 PBS buffer에 보존됩니다. JAM3 (JAM-C) 연구용으로 검증된 고품질 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003417-100 Anti-JAM3 Antibody, junctional adhesion molecule 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003417-25 Anti-JAM3 Antibody, junctional adhesion molecule 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-JAM3 Antibody

Anti-JAM3 Antibody

Target: Junctional adhesion molecule 3 (JAM3, JAM-C)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human JAM3, also known as junctional adhesion molecule 3 (JAM-C).


Alternative Gene Names

  • JAM-C
  • JAMC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Junctional adhesion molecule 3
Target Gene JAM3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (87%), Rat (85%)

Antigen Sequence:
RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG


Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.