Atlas Antibodies Anti-ITPR3 Antibody

상품 한눈에 보기

Human ITPR3 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제조됨. IHC 등 다양한 응용에 적합하며, 높은 종간 상동성을 가짐. 40% glycerol과 PBS buffer로 안정화되어 장기 보관 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003915-100 Anti-ITPR3 Antibody, inositol 1,4,5-trisphosphate receptor, type 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003915-25 Anti-ITPR3 Antibody, inositol 1,4,5-trisphosphate receptor, type 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: inositol 1,4,5-trisphosphate receptor, type 3 (ITPR3)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies

Polyclonal antibody against human ITPR3 (inositol 1,4,5-trisphosphate receptor, type 3).
Alternative gene name: IP3R3

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLLCENHNRD

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000052795	89%
Mouse	ENSMUSG00000042644	86%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen
Applications	Immunohistochemistry (IHC) 등
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.