CacheBy
Atlas Antibodies Anti-ITPR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITPR2 Antibody

상품 한눈에 보기

Human ITPR2 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식 사용. Human 반응성 검증 완료 및 높은 종간 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062260-100 Anti-ITPR2 Antibody, inositol 1,4,5-trisphosphate receptor, type 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062260-25 Anti-ITPR2 Antibody, inositol 1,4,5-trisphosphate receptor, type 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITPR2 Antibody

Anti-ITPR2 Antibody

Target Information

  • Target Protein: Inositol 1,4,5-trisphosphate receptor, type 2
  • Target Gene: ITPR2
  • Alternative Gene Names: CFAP48, IP3R2

Product Description

Polyclonal antibody against human ITPR2.

IHC (Immunohistochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000030287 85%
Rat ENSRNOG00000053339 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.