CacheBy
Atlas Antibodies Anti-ISLR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ISLR2 Antibody

상품 한눈에 보기

Human ISLR2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. ISLR2 유전자의 단백질 발현 연구에 사용. PrEST 항원을 이용한 Affinity purification. Human에 특이적으로 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067333-100 Anti-ISLR2 Antibody, immunoglobulin superfamily containing leucine-rich repeat 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067333-25 Anti-ISLR2 Antibody, immunoglobulin superfamily containing leucine-rich repeat 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ISLR2 Antibody

Anti-ISLR2 Antibody

Target: immunoglobulin superfamily containing leucine-rich repeat 2 (ISLR2)

Description: Polyclonal Antibody against Human ISLR2


  • Immunohistochemistry (IHC)

Alternative Gene Names

  • KIAA1465

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein immunoglobulin superfamily containing leucine-rich repeat 2
Target Gene ISLR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (84%), Rat (81%)

Antigen Sequence:

GLAFVLHCIADGHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGAEEGEGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEAGVYTCRAHNELGANSTSIR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.