CacheBy
Atlas Antibodies Anti-ISLR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ISLR Antibody

상품 한눈에 보기

Human ISLR 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보임. 40% 글리세롤 및 PBS 완충액에 보관.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050811-100 Anti-ISLR Antibody, immunoglobulin superfamily containing leucine-rich repeat 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050811-25 Anti-ISLR Antibody, immunoglobulin superfamily containing leucine-rich repeat 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ISLR Antibody

Anti-ISLR Antibody

Target: immunoglobulin superfamily containing leucine-rich repeat (ISLR)
Type: Polyclonal Antibody against Human ISLR


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against the human ISLR protein.


Alternative Gene Names

  • HsT17563

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein immunoglobulin superfamily containing leucine-rich repeat
Target Gene ISLR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG
Verified Species Reactivity Human
Interspecies Identity Rat (91%), Mouse (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.