Atlas Antibodies Anti-IRS2 Antibody

상품 한눈에 보기

인슐린 수용체 기질 단백질 2(IRS2)를 인식하는 인간 유래 폴리클로날 항체로, 토끼에서 생산됨. 면역형광 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 반응하며 마우스·랫과 높은 서열 유사성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054664-100 Anti-IRS2 Antibody, insulin receptor substrate 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054664-25 Anti-IRS2 Antibody, insulin receptor substrate 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Insulin receptor substrate 2
Target Gene: IRS2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQAS

Highest antigen sequence identity to the following orthologs:

Polyclonal antibody against human IRS2.

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand