CacheBy
Atlas Antibodies Anti-IRGQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRGQ Antibody

상품 한눈에 보기

Human IRGQ 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Orthogonal 및 Independent validation을 통해 신뢰성 검증. Affinity purification으로 고순도 확보. 다양한 조직에서 RNA-seq 데이터 기반 발현 비교 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050338-100 Anti-IRGQ Antibody, immunity-related GTPase family, Q 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050338-25 Anti-IRGQ Antibody, immunity-related GTPase family, Q 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRGQ Antibody

Anti-IRGQ Antibody

Target: immunity-related GTPase family, Q
Supplier: Atlas Antibodies

  • Orthogonal validation: IHC 기반 단백질 발현 검증, 고·저 발현 조직의 RNA-seq 데이터와 비교
  • Independent validation: 서로 다른 epitope을 인식하는 독립 항체 간 WB 비교를 통한 단백질 발현 검증

Product Description

Polyclonal antibody against Human IRGQ.

Alternative Gene Names

FKSG27, IRGQ1

Open Datasheet

Target Information

항목 내용
Target Protein immunity-related GTPase family, Q
Target Gene IRGQ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PPGLGKSALIAALCDKDVETLEAPEGRPDSGVPSLRAAGPGLFLGELSCPPAAPGPWAAEANVLVLVLPGPEGNGEPLAPAL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000046500 (83%), Mouse ENSMUSG00000041037 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 실험 목적에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
IHC Orthogonal Tooltip
WB Independent Validation
WB Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.