CacheBy
Atlas Antibodies Anti-IQCG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IQCG Antibody

상품 한눈에 보기

Human IQCG 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 및 WB에 적합하며, RNA-seq 데이터와 비교한 Orthogonal Validation을 거쳤습니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051981-100 Anti-IQCG Antibody, IQ motif containing G 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051981-25 Anti-IQCG Antibody, IQ motif containing G 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IQCG Antibody

Anti-IQCG Antibody

제품 개요

Human IQCG (IQ motif containing G)를 인식하는 폴리클로날 항체입니다.
Rabbit에서 생산되었으며, Affinity purification을 통해 높은 순도를 확보했습니다.

권장 응용

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

제품 설명

  • Polyclonal Antibody against Human IQCG
  • Orthogonal validation 수행
  • 높은 특이성과 재현성 제공

대체 유전자명

CFAP122, DKFZp434B227, DRC9

Open Datasheet

항원 정보

Target Protein: IQ motif containing G
Target Gene: IQCG
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQA

종 반응성 검증

Verified Species Reactivity: Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000035578 (47%)
  • Rat ENSRNOG00000026420 (42%)

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.