
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IPP Antibody
상품 한눈에 보기
Human IPP 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. KLHL27 유전자 대응. PrEST 항원을 이용해 Affinity 정제됨. PBS 및 glycerol buffer에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075545-100 Anti-IPP Antibody, intracisternal A particle-promoted polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075545-25 Anti-IPP Antibody, intracisternal A particle-promoted polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IPP Antibody
Anti-IPP Antibody
Target: intracisternal A particle-promoted polypeptide (IPP)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.
Product Description
Polyclonal antibody against Human IPP (intracisternal A particle-promoted polypeptide).
Alternative Gene Names
- KLHL27
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | intracisternal A particle-promoted polypeptide |
| Target Gene | IPP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SGLGVTVLGGMVYAIGGEKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPD |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000016183 (96%), Mouse ENSMUSG00000028696 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 실험 목적에 맞게 설정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



