CacheBy
Atlas Antibodies Anti-ING4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ING4 Antibody

상품 한눈에 보기

Human ING4 단백질을 인식하는 Rabbit Polyclonal 항체로, 성장 억제 단백질 연구에 적합. 높은 종간 보존성(인간-마우스 99%)을 가지며, Affinity purification으로 높은 특이도 제공. ICC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057338-100 Anti-ING4 Antibody, inhibitor of growth family, member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057338-25 Anti-ING4 Antibody, inhibitor of growth family, member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ING4 Antibody

Anti-ING4 Antibody

Target: Inhibitor of growth family, member 4 (ING4)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human ING4 protein. Suitable for various immunoassays including ICC.


Alternative Gene Names

  • my036
  • p29ING4

Target Information

항목 내용
Target Protein Inhibitor of growth family, member 4
Target Gene ING4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH

Verified Species Reactivity

  • Human

Interspecies Information

Gene ID 항원 서열 유사도
Mouse ENSMUSG00000030330 99%
Rat ENSRNOG00000023363 93%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

  • ICC (Immunocytochemistry)

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.