AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ING5 Antibody
상품 한눈에 보기
Human ING5 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042685-100 Anti-ING5 Antibody, inhibitor of growth family, member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042685-25 Anti-ING5 Antibody, inhibitor of growth family, member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ING5 Antibody
Anti-ING5 Antibody
Target: Inhibitor of growth family, member 5 (ING5)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human ING5 protein.
Alternative Gene Names
FLJ23842, p28ING5
Applications
Recommended for immunohistochemistry (IHC) and related assays.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Inhibitor of growth family, member 5 |
| Target Gene | ING5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (ENSMUSG00000026283, 92%), Rat (ENSRNOG00000018988, 92%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 농도 및 조건 |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02% (preservative) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.