CacheBy
Atlas Antibodies Anti-IL7R Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL7R Antibody

상품 한눈에 보기

Human IL7R(CD127)을 인식하는 rabbit polyclonal antibody. Western blot 및 immunocytochemistry에 적합. PrEST 항원을 이용한 affinity purification. Human에 특이적이며 Rat, Mouse에 부분적 반응 가능. 40% glycerol 기반 PBS buffer에 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067550-100 Anti-IL7R Antibody, interleukin 7 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067550-25 Anti-IL7R Antibody, interleukin 7 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL7R Antibody

Anti-IL7R Antibody

Target Information

  • Target Protein: Interleukin 7 receptor
  • Target Gene: IL7R
  • Alternative Gene Names: CD127
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IL7R.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000058446 (66%)
  • Mouse ENSMUSG00000003882 (60%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 결정해야 합니다.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.