Atlas Antibodies Anti-IL9R Antibody

상품 한눈에 보기

Human IL9R을 인식하는 폴리클로날 항체로, interleukin 9 receptor 연구용에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용에 사용 가능. CD129 대체명으로도 알려짐.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063240-100 Anti-IL9R Antibody, interleukin 9 receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063240-25 Anti-IL9R Antibody, interleukin 9 receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against Human IL9R (interleukin 9 receptor).

Immunohistochemistry (IHC)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet