CacheBy
Atlas Antibodies Anti-ZNF326 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF326 Antibody

상품 한눈에 보기

Human ZNF326 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(마우스·랫 98%)을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028461-100 Anti-ZNF326 Antibody, zinc finger protein 326 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028461-25 Anti-ZNF326 Antibody, zinc finger protein 326 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF326 Antibody

Anti-ZNF326 Antibody

Target Information

  • Target Protein: zinc finger protein 326
  • Target Gene: ZNF326
  • Alternative Gene Names: FLJ20403, ZAN75, Zfp326, ZIRD

Product Description

Polyclonal antibody against human ZNF326, generated in rabbit.
Suitable for Western Blot (WB) and Immunocytochemistry (ICC).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    FNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSS

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000029290 98%
Rat ENSRNOG00000047761 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.