CacheBy
Atlas Antibodies Anti-ZNF326 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF326 Antibody

상품 한눈에 보기

Human ZNF326 단백질을 인식하는 rabbit polyclonal 항체로 WB 및 ICC에 추천됩니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(인간, 마우스, 랫드 98%)을 보입니다. 안정한 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028450-100 Anti-ZNF326 Antibody, zinc finger protein 326 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028450-25 Anti-ZNF326 Antibody, zinc finger protein 326 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF326 Antibody

Anti-ZNF326 Antibody

Target Information

  • Target Protein: Zinc finger protein 326
  • Target Gene: ZNF326
  • Alternative Gene Names: FLJ20403, ZAN75, Zfp326, ZIRD
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZNF326.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000047761): 98%
  • Mouse (ENSMUSG00000029290): 98%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.