원본
Thermo Fisher Scientific Human TGF-alpha, Animal-Free Recombinant Protein, PeproTech
상품 한눈에 보기
인체 유래 TGF-alpha 재조합 단백질로, EGF 수용체를 통해 세포 증식을 유도합니다. 동물성 성분이 없는 E. coli 발현 시스템에서 생산되며, ≥98% 고순도 및 낮은 엔도톡신 수준을 보장합니다. 기능적 세포 증식 분석에 적합한 연구용 시약입니다.
- 카탈로그번호
- AF-100-16A-250UG
- 카테고리
- Protein
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:33
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific AF-100-16A-250UG Human TGF-alpha, Animal-Free Recombinant Protein, PeproTech 250 ug pk판매 단위 pk
재고 1개
818,200원VAT 포함 900,020원
Thermo Fisher Scientific · Thermo Fisher Scientific Human TGF-alpha, Animal-Free Recombinant Protein, PeproTech
Applications
Functional Assay (Functional)
- Assay-dependent
In vitro Assay (IV)
- Refer to related publications
Miscellaneous PubMed (Misc)
- Refer to related publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published Species | Horse, Human, Rat |
| Expression System | E. coli |
| Amino Acid Sequence | VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
| Molecular Weight | 5.5 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 98% (SDS-PAGE 및 HPLC 분석 기준) |
| Endotoxin Concentration | < 0.1 EU/µg |
| Activity | Mouse Balb/c 3T3 세포 증식 자극 능력으로 측정됨. 예상 ED50 ≤ 0.2 ng/ml (특이 활성 ≥ 5 × 10⁶ units/mg). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
Product Specific Information
Recombinant Human TGF-alpha는 50개의 아미노산으로 구성된 5.5 kDa 폴리펩타이드로, EGF와 약 40%의 서열 상동성을 공유하며, 6개의 보존된 시스테인 잔기를 통해 3개의 이황화 결합을 형성합니다.
본 제품은 상온에서 배송되며, 보관 및 재구성 방법은 로트별 Certificate of Analysis를 참조하십시오.
Target Information
TGF-alpha는 EGF 관련 성장인자로, EGF 수용체를 통해 신호를 전달하며 다양한 표피 및 상피 세포의 증식을 자극합니다. 단핵구, 각질형성세포 및 여러 종양세포에서 생성되며, 배양 세포에서 부착 독립적 형태로의 변환을 유도합니다.
Human, murine, rat TGF-alpha는 종 간 교차 반응성이 있으며, EGF 수용체(EGFR)에 결합해 티로신 인산화를 활성화하고 세포 증식을 촉진합니다. 또한 가역적 변형된 표현형을 유도하여 종양 개시에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Human FGF-basic (FGF-2/bFGF) (146 aa), Animal-Free Recombinant Protein, PeproTech872,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Human FGF-basic (FGF-2/bFGF) (154 aa), Animal-Free Recombinant Protein, PeproTech161,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Human FGF-basic (FGF-2/bFGF) (146 aa), Animal-Free Recombinant Protein, PeproTech170,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Human TGF-alpha, Animal-Free Recombinant Protein, PeproTech170,100원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.