CacheBy
Atlas Antibodies Anti-ZEB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZEB2 Antibody

상품 한눈에 보기

인간 ZEB2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 분석에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성 제공. 다양한 세포주에서 ZEB2 발현 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003456-100 Anti-ZEB2 Antibody, zinc finger E-box binding homeobox 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003456-25 Anti-ZEB2 Antibody, zinc finger E-box binding homeobox 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZEB2 Antibody

Anti-ZEB2 Antibody

Target: zinc finger E-box binding homeobox 2 (ZEB2)
Type: Polyclonal Antibody against Human ZEB2


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human ZEB2


Alternative Gene Names

KIAA0569, SIP-1, SIP1, ZFHX1B

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger E-box binding homeobox 2
Target Gene ZEB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004677 (95%), Mouse ENSMUSG00000026872 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.