
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZEB2 Antibody
상품 한눈에 보기
인간 ZEB2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 분석에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성 제공. 다양한 세포주에서 ZEB2 발현 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003456-100 Anti-ZEB2 Antibody, zinc finger E-box binding homeobox 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003456-25 Anti-ZEB2 Antibody, zinc finger E-box binding homeobox 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZEB2 Antibody
Anti-ZEB2 Antibody
Target: zinc finger E-box binding homeobox 2 (ZEB2)
Type: Polyclonal Antibody against Human ZEB2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human ZEB2
Alternative Gene Names
KIAA0569, SIP-1, SIP1, ZFHX1B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger E-box binding homeobox 2 |
| Target Gene | ZEB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000004677 (95%), Mouse ENSMUSG00000026872 (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



