CacheBy
Atlas Antibodies Anti-ZFAND2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZFAND2B Antibody

상품 한눈에 보기

인간 ZFAND2B 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 응용에 적합함. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 높은 종간 보존도를 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035159-100 Anti-ZFAND2B Antibody, zinc finger, AN1-type domain 2B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035159-25 Anti-ZFAND2B Antibody, zinc finger, AN1-type domain 2B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZFAND2B Antibody

Anti-ZFAND2B Antibody

Target: zinc finger, AN1-type domain 2B
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ZFAND2B.

Alternative Gene Names

  • AIRAPL

Open Datasheet (PDF)

Target Information

  • Target Protein: zinc finger, AN1-type domain 2B
  • Target Gene: ZFAND2B
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000018639 91%
Mouse ENSMUSG00000026197 89%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.