Atlas Antibodies Anti-ZC3H15 Antibody

상품 한눈에 보기

인간 ZC3H15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간 및 설치류 간 높은 서열 유사성을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031101-100 Anti-ZC3H15 Antibody, zinc finger CCCH-type containing 15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031101-25 Anti-ZC3H15 Antibody, zinc finger CCCH-type containing 15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger CCCH-type containing 15
Supplier: Atlas Antibodies

IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against Human ZC3H15.

Alternative Gene Names: LEREPO4
Open Datasheet (PDF)

항목	내용
Target Protein	zinc finger CCCH-type containing 15
Target Gene	ZC3H15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000027091 (97%) Rat ENSRNOG00000005256 (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

IVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITL

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.