CacheBy
Atlas Antibodies Anti-ZC3H15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZC3H15 Antibody

상품 한눈에 보기

인간 ZC3H15 단백질을 인식하는 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. 토끼 유래 IgG 항체로 PrEST 항원을 이용해 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031099-100 Anti-ZC3H15 Antibody, zinc finger CCCH-type containing 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031099-25 Anti-ZC3H15 Antibody, zinc finger CCCH-type containing 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZC3H15 Antibody

Anti-ZC3H15 Antibody

Target: zinc finger CCCH-type containing 15
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human ZC3H15.

Alternative Gene Names: LEREPO4
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger CCCH-type containing 15
Target Gene ZC3H15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
IVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITL
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000005256 (97%)
Mouse ENSMUSG00000027091 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.