CacheBy
Atlas Antibodies Anti-YARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-YARS2 Antibody

상품 한눈에 보기

Human YARS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 및 PBS 완충액에 보존 처리됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074097-100 Anti-YARS2 Antibody, tyrosyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074097-25 Anti-YARS2 Antibody, tyrosyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YARS2 Antibody

Anti-YARS2 Antibody

Target: tyrosyl-tRNA synthetase 2, mitochondrial (YARS2)

면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human YARS2

Alternative Gene Names

CGI-04, FLJ13995, mt-TyrRS

Open Datasheet (PDF)

Target Information

  • Protein: tyrosyl-tRNA synthetase 2, mitochondrial
  • Gene: YARS2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TSTTGAKLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGREG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000022792 93%
Rat ENSRNOG00000025252 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.