CacheBy
Atlas Antibodies Anti-YAP1 Antibody
원본

Atlas Antibodies Anti-YAP1 Antibody

상품 한눈에 보기

Human YAP1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 특이적이며 Mouse, Rat에서도 높은 서열 유사성을 보임. PBS와 glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA070359-100 Anti-YAP1 Antibody, Yes associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070359-25 Anti-YAP1 Antibody, Yes associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YAP1 Antibody

Anti-YAP1 Antibody

Target Information

  • Target Protein: Yes-associated protein 1
  • Target Gene: YAP1
  • Alternative Gene Names: YAP65

이미지 내 텍스트(OCR): Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human YAP1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000053110 (86%)
  • Rat ENSRNOG00000005933 (83%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.